{"product_id":"royal-jelly-skin-lifting-care-package","title":"Royal Jelly Skin Lifting Care Package","description":"\u003c!-- Start tab labels --\u003e\n\u003cul class=\"tabs\"\u003e\n  \u003cli\u003e\n    \u003ca class=\"active\" href=\"#tab1\"\u003eDESCRIPTION\u003c\/a\u003e\n  \u003c\/li\u003e\n  \u003cli\u003e\n    \u003ca href=\"#tab2\"\u003eHOW TO USE\u003c\/a\u003e\n  \u003c\/li\u003e\n  \u003cli\u003e\n    \u003ca href=\"#tab3\"\u003eINGREDIENTS\u003c\/a\u003e\n  \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003c!-- Start tab content --\u003e\n\u003cul class=\"tabs-content\"\u003e\n  \u003cli class=\"active\" id=\"tab1\" style=\"display: block;\"\u003e\n    \u003cdiv\u003e\n      \u003cp\u003e\n        Transform your skincare regimen with our comprehensive 5-piece luxury treatment collection. By combining the power of \n        \u003cstrong\u003ecellular oxygenation, gold ion exchange, nutrient-dense royal jelly, and precious Bulgarian rose\u003c\/strong\u003e, \n        this synergistic system works in harmony to detoxify, firm, deeply hydrate, and restore youthful radiance.\n      \u003c\/p\u003e\n\n      \u003cp\u003eThis package is composed of:\u003c\/p\u003e\n\n      \u003cp\u003e\u003cstrong\u003e1. Erlin Purifying \u0026amp; Detoxifying Carbon Mask\u003c\/strong\u003e\u003c\/p\u003e\n      \u003cul\u003e\n        \u003cli\u003e\n          \u003cem\u003eCO₂-Activated Bohr Effect \u0026amp; Micro-Vascular Stimulator\u003c\/em\u003e\n        \u003c\/li\u003e\n        \u003cli\u003e\n          Utilizing patented CO₂ technology to trigger the Bohr Effect, this revolutionary mask stimulates skin cells to release oxygen and nutrients naturally while inducing lymphatic drainage. It boosts microcirculation, flushes out toxins, and minimizes the appearance of pores, visibly reviving dull, sluggish skin.\n        \u003c\/li\u003e\n      \u003c\/ul\u003e\n\n      \u003cp\u003e\u003cstrong\u003e2. Itaca Gold Royal Jelly Ampoule Kit\u003c\/strong\u003e\u003c\/p\u003e\n      \u003cul\u003e\n        \u003cli\u003e\n          \u003cem\u003eIon-Exchange Gold Carrier \u0026amp; Lyophilized Bio-Nutritives\u003c\/em\u003e\n        \u003c\/li\u003e\n        \u003cli\u003e\n          Powered by freeze-dried Royal Jelly and Pure Gold particles (P1) with Gold Royal Jelly Solution (P2), this high-potency formula uses ion-exchange technology to draw out impurities like trapped metals or deeply-embedded metabolic waste, while repairing weakened skin, enhancing elasticity, and strengthening your skin's natural defenses.\n        \u003c\/li\u003e\n      \u003c\/ul\u003e\n\n      \u003cp\u003e\u003cstrong\u003e3. Itaca Gold Lifting Royal Jelly Mask\u003c\/strong\u003e\u003c\/p\u003e\n      \u003cul\u003e\n        \u003cli\u003e\n          \u003cem\u003ePeptide-Driven Dermal Tightener \u0026amp; Tissue Sculptor\u003c\/em\u003e\n        \u003c\/li\u003e\n        \u003cli\u003e\n          Designed to deliver a non-invasive lifting effect. High-concentration peptides combined with Snail Secretion Filtrate cross-link with skin proteins to detoxify, smooth surface texture, reduce the appearance of wrinkles, and bind moisture. Botanical anti-inflammatories like Calendula ensure high-potency lifting without vascular irritation.\n        \u003c\/li\u003e\n      \u003c\/ul\u003e\n\n      \u003cp\u003e\u003cstrong\u003e4. Itaca Losa Meloso Mask\u003c\/strong\u003e\u003c\/p\u003e\n      \u003cul\u003e\n        \u003cli\u003e\n          \u003cem\u003ePhyto-Lipid Barrier Replenisher \u0026amp; Regenerative Compounding\u003c\/em\u003e\n        \u003c\/li\u003e\n        \u003cli\u003e\n          Infused with rare Bulgarian Damascus Rose, this rich compounding treatment repairs compromised lipid barriers. Combined with Bio-Soybean Isoflavones, Shea Butter, and Centella Asiatica, it accelerates cellular turnover, rebuilds density in thinning or fatigued skin, and leaves behind a glowing complexion.\n        \u003c\/li\u003e\n      \u003c\/ul\u003e\n\n      \u003cp\u003e\u003cstrong\u003e5. Itaca Losa Meloso Gel Mineral\u003c\/strong\u003e\u003c\/p\u003e\n      \u003cul\u003e\n        \u003cli\u003e\n          \u003cem\u003eChitosan-Infused Capillary Stabilizer \u0026amp; Universal Conductive Base\u003c\/em\u003e\n        \u003c\/li\u003e\n        \u003cli\u003e\n          The ultimate multi-tasker for stressed skin. Chitosan forms a bio-compatible, healing film over micro-tears, while mineral-rich Damask Rose and Aloe calm capillary redness instantly. Its unique formulation makes it an extraordinary cooling post-treatment mask, sleep pack, or glide-gel for facial and body sculpting.\n        \u003c\/li\u003e\n      \u003c\/ul\u003e\n\n      \u003cp\u003e\n        While each product delivers exceptional individual results, combining them creates an unrivaled beauty routine:\n      \u003c\/p\u003e\n\n      \u003cul\u003e\n        \u003cli\u003e\n          \u003cstrong\u003eDeep Detoxification meets Rapid Cellular Renewal:\u003c\/strong\u003e \n          Erlin’s CO₂ Carbon Mask purifies pores and activates oxygenation, creating the optimal clean slate for Itaca’s Gold Royal Jelly Ampoule Kit to deeply penetrate and restore skin elasticity.\n        \u003c\/li\u003e\n\n        \u003cli\u003e\n          \u003cstrong\u003eFirming \u0026amp; Lifting Amplified:\u003c\/strong\u003e \n          The Gold Lifting Royal Jelly Mask locks in high-potency peptides and freeze-dried royal jelly, instantly firming and contouring sagging skin.\n        \u003c\/li\u003e\n\n        \u003cli\u003e\n          \u003cstrong\u003eIntense Moisture \u0026amp; Soothing Balance:\u003c\/strong\u003e \n          The soothing botanical properties of the Losa Meloso Mask and Losa Meloso Gel Mineral calm skin reactivity, strengthen the moisture barrier, and leave the face and body deeply hydrated with a luminous glow.\n        \u003c\/li\u003e\n      \u003c\/ul\u003e\n    \u003c\/div\u003e\n  \u003c\/li\u003e\n\n\u003cli id=\"tab2\" style=\"display: none;\"\u003e\n  \u003cdiv\u003e\n    \u003cp\u003e\n      Each product can be used separately or incorporated into your desired protocol or routine:\n    \u003c\/p\u003e\n\n    \u003cp\u003e\n      \u003cstrong\u003eDetox \u0026amp; Oxygenate:\u003c\/strong\u003e Apply \u003cstrong\u003eErlin Carbon Mask\u003c\/strong\u003e to flush pores and jumpstart circulation.\n    \u003c\/p\u003e\n\n    \u003col\u003e\n      \u003cli\u003e\n        Apply the CO₂ Solution (Activator Gel): Dispense and apply approximately 70% of the solution evenly over the entire face using a brush, spatula, or clean hands.\n        \u003col type=\"a\"\u003e\n          \u003cli\u003e\n            Ensure full, even coverage for proper chemical reaction and oxygen release.\n          \u003c\/li\u003e\n          \u003cli\u003e\n            Avoid applying too close to the eyes or directly on open wounds.\n          \u003c\/li\u003e\n        \u003c\/ol\u003e\n      \u003c\/li\u003e\n\n      \u003cli\u003e\n        Apply the Neck Mask (Bottom Sheet): Place the lower sheet mask onto the neck area and secure it by hooking it over both ears.\n        \u003col type=\"a\"\u003e\n          \u003cli\u003e\n            Ensure the mask is in full contact with the skin to allow consistent CO₂ reaction.\n          \u003c\/li\u003e\n          \u003cli\u003e\n            Smooth out air bubbles for better adherence and uniform treatment.\n          \u003c\/li\u003e\n        \u003c\/ol\u003e\n      \u003c\/li\u003e\n\n      \u003cli\u003e\n        Apply the Facial Mask (Top Sheet): Apply the upper sheet mask to the face, aligning with the eyes, nose, and mouth.\n        \u003col type=\"a\"\u003e\n          \u003cli\u003e\n            Press gently to ensure full contact with the solution and skin surface.\n          \u003c\/li\u003e\n        \u003c\/ol\u003e\n      \u003c\/li\u003e\n\n      \u003cli\u003e\n        Activate Circulation with Gentle Pressure: Using clean hands, apply light pressure across the face and neck, gently smoothing the mask to stimulate the Bohr Effect and enhance oxygenation and circulation.\n        \u003col type=\"a\"\u003e\n          \u003cli\u003e\n            Expect a mild tingling or warming sensation—this indicates the CO₂ activation and detoxification process is underway.\n          \u003c\/li\u003e\n        \u003c\/ol\u003e\n      \u003c\/li\u003e\n\n      \u003cli\u003e\n        Reactivate with Remaining Solution: After 7 to 10 minutes, apply the remaining 30% of the solution directly on top of the mask, focusing on drier or less reactive areas.\n        \u003col type=\"a\"\u003e\n          \u003cli\u003e\n            This re-saturates the sheets and intensifies the CO₂ exchange and hydration.\n          \u003c\/li\u003e\n        \u003c\/ol\u003e\n      \u003c\/li\u003e\n\n      \u003cli\u003e\n        Remove \u0026amp; Pat in Excess: After an additional 3 to 5 minutes, carefully remove the mask sheets starting from the neck.\n        \u003col type=\"a\"\u003e\n          \u003cli\u003e\n            Gently pat in any remaining essence until fully absorbed.\n          \u003c\/li\u003e\n          \u003cli\u003e\n            \u003cstrong\u003eDo not rinse.\u003c\/strong\u003e The post-treatment glow and active ingredients should remain on the skin.\n          \u003c\/li\u003e\n        \u003c\/ol\u003e\n      \u003c\/li\u003e\n\n      \u003cli\u003e\n        Tip: The CO₂ mask can be applied for up to 20 to 30 minutes for maximum benefit; however, shorter sessions of 10 to 15 minutes are also highly effective, especially for sensitive skin or first-time users. Adjust the duration based on your skin's tolerance and desired results.\n      \u003c\/li\u003e\n    \u003c\/ol\u003e\n\n    \u003cp\u003e\n      \u003cstrong\u003eInfuse \u0026amp; Nourish:\u003c\/strong\u003e Massage in the \u003cstrong\u003eGold Royal Jelly Ampoule Kit\u003c\/strong\u003e to target elasticity and barrier repair.\n    \u003c\/p\u003e\n\n    \u003col\u003e\n      \u003cli\u003ePrep: Start with cleansed and toned skin.\u003c\/li\u003e\n      \u003cli\u003eMix: Combine the contents of a P1 powder and P2 solution in one bottle.\u003c\/li\u003e\n      \u003cli\u003eApply: Spread an appropriate amount of the combined solution evenly across the face.\u003c\/li\u003e\n      \u003cli\u003eMassage: Gently massage from the center outward toward the hairline.\u003c\/li\u003e\n      \u003cli\u003eFinish: Pat until absorbed, then follow with moisturizer.\u003c\/li\u003e\n    \u003c\/ol\u003e\n\n    \u003cp\u003e\n      \u003cstrong\u003eLift \u0026amp; Firm:\u003c\/strong\u003e Layer the \u003cstrong\u003eGold Lifting Royal Jelly Mask\u003c\/strong\u003e to seal in nutrients and smooth fine lines.\n    \u003c\/p\u003e\n\n    \u003col\u003e\n      \u003cli\u003e\n        Preparation: Start with a clean, dry face to ensure maximum absorption of the active ingredients.\n      \u003c\/li\u003e\n      \u003cli\u003e\n        Application: Apply a generous, even layer of the mask to the entire face, avoiding the immediate eye and lip areas.\n      \u003c\/li\u003e\n      \u003cli\u003e\n        Treatment: Leave the mask on for 15 minutes, allowing the formula to set and the nutrients to penetrate the skin.\n      \u003c\/li\u003e\n      \u003cli\u003e\n        Removal: Rinse thoroughly with lukewarm water until all product is removed, then follow with your favorite moisturizer.\n      \u003c\/li\u003e\n    \u003c\/ol\u003e\n\n    \u003cp\u003e\n      \u003cstrong\u003ePlump \u0026amp; Soothe:\u003c\/strong\u003e Apply the \u003cstrong\u003eLosa Meloso Mask\u003c\/strong\u003e for deep moisture and youthful radiance.\n    \u003c\/p\u003e\n\n    \u003col\u003e\n      \u003cli\u003e\n        Apply an appropriate amount of the Losa Meloso Mask evenly across your cleansed face.\n      \u003c\/li\u003e\n      \u003cli\u003e\n        Wait for 10-15 minutes.\n      \u003c\/li\u003e\n      \u003cli\u003e\n        Rinse off with lukewarm water and gently pat your face dry.\n      \u003c\/li\u003e\n    \u003c\/ol\u003e\n\n    \u003cp\u003e\n      \u003cstrong\u003eCalm \u0026amp; Protect:\u003c\/strong\u003e Finish or reset anytime with the \u003cstrong\u003eLosa Meloso Gel Mineral\u003c\/strong\u003e for head-to-toe soothing hydration.\n    \u003c\/p\u003e\n\n    \u003col\u003e\n      \u003cli\u003e\n        As a Soothing Mask or Essence: Apply a generous amount of the product directly onto clean, dry skin. Gently spread it over the face, focusing on areas that need calming relief. Leave it on for 10-15 minutes, allowing the skin to absorb the essence fully. Rinse off or pat in the remaining product for a soothing finish.\n      \u003c\/li\u003e\n      \u003cli\u003e\n        Mix with Massage Cream: For enhanced calmness and a non-sticky texture, mix a small amount of the product with your preferred massage cream. Massage gently onto the skin in upward motions, helping the skin to absorb the soothing ingredients while promoting relaxation.\n      \u003c\/li\u003e\n      \u003cli\u003e\n        Refrigerate for a Cooling Effect: For an extra refreshing sensation, store the product in the refrigerator before use. Apply it chilled for a cooling and calming effect, especially after exposure to heat or irritation.\n      \u003c\/li\u003e\n      \u003cli\u003e\n        For Scalp Massage \u0026amp; Smoother Skin: Use this product in combination with the Rosa Meloso mask for an ideal scalp massage. Apply it to the scalp and massage gently to promote relaxation and smoother skin, enhancing the overall treatment.\n      \u003c\/li\u003e\n    \u003c\/ol\u003e\n  \u003c\/div\u003e\n\u003c\/li\u003e\n\n\u003cli id=\"tab3\" style=\"display: none;\"\u003e\n  \u003cdiv\u003e\n    \u003cp\u003e\n      \u003cstrong\u003e[Erlin Purifying \u0026amp; Detoxifying Carbon Mask]\u003c\/strong\u003e\n      Water, Sodium Bicarbonate, Glycerin, Pine Bark Extract, Eucalyptus Oil, Honeysuckle Flower Extract, Glycyrrhiza Uralensis (Licorice) Root Extract, Methylparaben, Phenoxyethanol, Eucalyptus Globulus Leaf Oil, Pinus Densiflora Extract, Quercus Acutissima Fruit Extract, Angelica Dahurica Root Extract, Angelica Extract, Lonicera Japonica Bud Extract, Rosa Extract, Cnidium Officinale Root Extract, Chrysanthemum Morifolium Flower Extract, Rosa Rugosa Flower Extract, Sophora Root, Xanthan Gum\n    \u003c\/p\u003e\n\n    \u003cp\u003e\n      \u003cstrong\u003e[Itaca Gold Royal Jelly Ampoule Kit]\u003c\/strong\u003e\n      Royal Jelly Powder, Glycine, Acacia Senegal Gum Extract, Water, Ethylhexyl Stearate, Cetearyl Isononanoate, Glycerin, Triticum Vulgare (Wheat) Germ Oil, Ceteareth-20, Glyceryl Stearate, Ceteareth-12, Cetearyl Alcohol, Cetyl Palmitate, Ethylhexyl Methoxycinnamate, Tocopheryl Acetate, Caprylyl Glycol, Sodium Levulinate, Sodium Anisate, Mica, Titanium Dioxide, Iron Oxides\n    \u003c\/p\u003e\n\n    \u003cp\u003e\n      \u003cstrong\u003e[Itaca Gold Lifting Royal Jelly Mask]\u003c\/strong\u003e\n      Water, Pectin, Sodium Acrylate\/Vinyl Alcohol Copolymer, Alcohol, 1,2-Hexanediol, Cellulose Gum, Hydrolyzed Collagen, Sodium Polystyrene Sulfonate, Copper Tripeptide-1, Acetyl Hexapeptide-8, Snail Secretion Filtrate, Chamomilla Recutita (Matricaria) Flower Extract, Calendula Officinalis Extract, Castanea Crenata (Chestnut) Shell Extract, Adenosine, Glycerin, Butylene Glycol, CI 77480, Propolis Extract, Royal Jelly Extract, Theobroma Cacao (Cocoa) Fruit Powder, Mica, Polysorbate 80, Arginine, Carbomer, Titanium Dioxide, Iron Oxide Red (CI 77491), Chlorphenesin, Ethylhexylglycerin, Disodium EDTA, Linalool, Fragrance\n    \u003c\/p\u003e\n\n    \u003cp\u003e\n      \u003cstrong\u003e[Itaca Losa Meloso Mask]\u003c\/strong\u003e\n      Aqua (Water), Maltodextrin, Glycerin, Ethylhexyl Stearate, Oryza Sativa (Rice) Extract, Glyceryl Stearate, Cetearyl Alcohol, Stearoxytrimethylsilane, Rosa Damascena Flower Oil, Butyrospermum Parkii (Shea) Butter, Centella Asiatica Extract, Sucrose, Carbomer, Propylene Glycol, Glycine Soja (Soybean) Protein, Polyacrylamidomethylpropane Sulfonic Acid, Cera Alba (Beeswax), Sorbitan Stearate, Rose Flower Oil, Caprylyl Glycol, Sodium Levulinate, Sodium Anisate, Isopropyl Myristate, C13-14 Isoparaffin\n    \u003c\/p\u003e\n\n    \u003cp\u003e\n      \u003cstrong\u003e[Itaca Losa Meloso Gel Mineral]\u003c\/strong\u003e\n      Water, Glycerin, Alcohol, Butylene Glycol, Sodium Hyaluronate, Carbomer, Macadamia Ternifolia Seed Oil, Arginine, Fragrance, Pulsatilla Koreana Root Extract, Hydrogenated Castor Oil, Allantoin, Simmondsia Chinensis (Jojoba) Seed Oil, Usnea Barbata (Lichen) Extract, Zanthoxylum Piperitum (Japanese Pepper) Seed Oil, Rosa Damascena Flower Oil, CI 14700\n    \u003c\/p\u003e\n  \u003c\/div\u003e\n\u003c\/li\u003e\n\u003c\/ul\u003e","brand":"Dermafirm USA","offers":[{"title":"Default Title","offer_id":51412452311286,"sku":null,"price":720.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0324\/7302\/2601\/files\/royaljellyskinliftingcarepackageimg.png?v=1785540185","url":"https:\/\/dermafirmusa.com\/products\/royal-jelly-skin-lifting-care-package","provider":"Dermafirm USA","version":"1.0","type":"link"}